Recombinant Rat Olfm3 protein, His-tagged
Cat.No. : | Olfm3-3432R |
Product Overview : | Recombinant Rat Olfm3 protein(P63057)(24-478aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-478aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QTLPSLVGLNTTRLSAPDTLTQISPKEGWQVYSSAQDPDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSSVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDLGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT |
Gene Name | Olfm3 olfactomedin 3 [ Rattus norvegicus ] |
Official Symbol | Olfm3 |
Synonyms | OLFM3; olfactomedin 3; noelin-3; optimedin; olfactomedin-3; |
Gene ID | 252920 |
mRNA Refseq | NM_145777 |
Protein Refseq | NP_665720 |
◆ Recombinant Proteins | ||
Olfm3-3432R | Recombinant Rat Olfm3 protein, His-tagged | +Inquiry |
Olfm3-8000M | Recombinant Mouse Olfm3 protein, His & T7-tagged | +Inquiry |
OLFM3-7999H | Recombinant Human OLFM3 protein, His & T7-tagged | +Inquiry |
OLFM3-6335M | Recombinant Mouse OLFM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
OLFM3-3164R | Recombinant Rhesus monkey OLFM3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLFM3-3581HCL | Recombinant Human OLFM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Olfm3 Products
Required fields are marked with *
My Review for All Olfm3 Products
Required fields are marked with *
0
Inquiry Basket