Recombinant Rat Orm1 protein, His-tagged
Cat.No. : | Orm1-4450R |
Product Overview : | Recombinant Rat Orm1 protein(P02764)(19-205aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-205aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.7 kDa |
AA Sequence : | QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Orm1 orosomucoid 1 [ Rattus norvegicus ] |
Official Symbol | Orm1 |
Synonyms | ORM1; orosomucoid 1; Agpa1; |
Gene ID | 170531 |
◆ Recombinant Proteins | ||
ORM1-3571H | Recombinant Human ORM1 | +Inquiry |
ORM1-638HFL | Recombinant Full Length Human ORM1 Protein, C-Flag-tagged | +Inquiry |
ORM1-4202R | Recombinant Rat ORM1 Protein | +Inquiry |
Orm1-1076R | Recombinant Rat Orm1 protein | +Inquiry |
ORM1-01H | Recombinant Human ORM1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
ORM1-8016R | Native Rabbit Serum Alpha-1-Acid GlycoProtein | +Inquiry |
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
ORM1-27283TH | Native Human ORM1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ORM1-3549HCL | Recombinant Human ORM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Orm1 Products
Required fields are marked with *
My Review for All Orm1 Products
Required fields are marked with *
0
Inquiry Basket