Recombinant Rat Orm1 protein, His-tagged
| Cat.No. : | Orm1-4450R |
| Product Overview : | Recombinant Rat Orm1 protein(P02764)(19-205aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-205aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 25.7 kDa |
| AA Sequence : | QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Orm1 orosomucoid 1 [ Rattus norvegicus ] |
| Official Symbol | Orm1 |
| Synonyms | ORM1; orosomucoid 1; Agpa1; |
| Gene ID | 170531 |
| ◆ Recombinant Proteins | ||
| ORM1-3571H | Recombinant Human ORM1 | +Inquiry |
| Orm1-7749R | Recombinant Rat Orm1 protein, His & T7-tagged | +Inquiry |
| ORM1-01H | Recombinant Human ORM1 Protein, His-tagged | +Inquiry |
| ORM1-3864R | Recombinant Rat ORM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ORM1-0581H | Recombinant Human ORM1 Protein (Gln19-Ser201), His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ORM1-26392TH | Native Human ORM1 | +Inquiry |
| ORM1-8013H | Native Human Serum Alpha-1-Acid GlycoProtein | +Inquiry |
| ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
| ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
| ORM1-27283TH | Native Human ORM1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ORM1-3549HCL | Recombinant Human ORM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Orm1 Products
Required fields are marked with *
My Review for All Orm1 Products
Required fields are marked with *
