Recombinant Rat Osm protein, His-tagged
| Cat.No. : | Osm-4527R |
| Product Overview : | Recombinant Rat Osm protein(Q65Z15)(26-208aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 26-208aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.2 kDa |
| AA Sequence : | KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Osm oncostatin M [ Rattus norvegicus ] |
| Official Symbol | Osm |
| Synonyms | OSM; oncostatin M; |
| Gene ID | 114841 |
| ◆ Recombinant Proteins | ||
| Osm-10606M | Recombinant Mouse Osm Protein, His (Fc)-Avi-tagged | +Inquiry |
| OSM-656H | Active Recombinant Human OSM, His-tagged, Biotinylated | +Inquiry |
| OSM-563R | Recombinant Rhesus macaque OSM protein, His-tagged | +Inquiry |
| OSM-513H | Recombinant Human OSM protein | +Inquiry |
| OSM-4772H | Recombinant Human OSM Protein (Ala26-Arg252), C-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| Osm-3256R | Recombinant Rhesus Monkey OSM Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
| OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Osm Products
Required fields are marked with *
My Review for All Osm Products
Required fields are marked with *
