Recombinant Rat Pdgfa protein
Cat.No. : | Pdgfa-375R |
Product Overview : | Recombinant Rat Pdgfa protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 111 |
Description : | Alpha chain of platelet derived growth factor; acts as a homodimer or heterodimer with PDGF beta to activate PDGF receptors. |
Form : | Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 25.3 kDa, a disulfide-linked homodimeric protein containing two 111 amino acid residues polypeptide (A chain). |
AA Sequence : | MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETDVR |
Endotoxin : | Less than 0.1 EU/μg of rRtPDGF-AA as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Pdgfa |
Official Symbol | Pdgfa |
Synonyms | PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF-1; PDGF subunit A; platelet derived growth factor, alpha; Platelet-derived growth factor A chain; PDGFACP; |
Gene ID | 25266 |
mRNA Refseq | NM_012801 |
Protein Refseq | NP_036933 |
UniProt ID | P28576 |
◆ Recombinant Proteins | ||
PDGFA-923C | Recombinant Canine PDGFA Protein (Ser87-Arg196), His-tagged | +Inquiry |
Pdgfa-304M | Active Recombinant Mouse Pdgfa | +Inquiry |
PDGFA-174H | Recombinant Human PDGFA protein, His/S-tagged | +Inquiry |
Pdgfa-175M | Recombinant Mouse Pdgfa protein, His/S-tagged | +Inquiry |
Pdgfa-1930R | Recombinant Rat Pdgfa Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFA-3337HCL | Recombinant Human PDGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pdgfa Products
Required fields are marked with *
My Review for All Pdgfa Products
Required fields are marked with *
0
Inquiry Basket