Species : |
Rat |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
111 |
Description : |
Alpha chain of platelet derived growth factor; acts as a homodimer or heterodimer with PDGF beta to activate PDGF receptors. |
Form : |
Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg. |
Molecular Mass : |
Approximately 25.3 kDa, a disulfide-linked homodimeric protein containing two 111 amino acid residues polypeptide (A chain). |
AA Sequence : |
MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETDVR |
Endotoxin : |
Less than 0.1 EU/μg of rRtPDGF-AA as determined by LAL method. |
Purity : |
>98% by SDS-PAGE and HPLC analyses. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |