Recombinant Rat Pdgfa protein

Cat.No. : Pdgfa-375R
Product Overview : Recombinant Rat Pdgfa protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 111
Description : Alpha chain of platelet derived growth factor; acts as a homodimer or heterodimer with PDGF beta to activate PDGF receptors.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 5.0 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 25.3 kDa, a disulfide-linked homodimeric protein containing two 111 amino acid residues polypeptide (A chain).
AA Sequence : MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETDVR
Endotoxin : Less than 0.1 EU/μg of rRtPDGF-AA as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Pdgfa
Official Symbol Pdgfa
Synonyms PDGFA; platelet-derived growth factor alpha polypeptide; platelet-derived growth factor subunit A; PDGF-1; PDGF subunit A; platelet derived growth factor, alpha; Platelet-derived growth factor A chain; PDGFACP;
Gene ID 25266
mRNA Refseq NM_012801
Protein Refseq NP_036933
UniProt ID P28576

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Pdgfa Products

Required fields are marked with *

My Review for All Pdgfa Products

Required fields are marked with *

0
cart-icon