Recombinant Rat PLA2G10 Protein, Fc tagged
Cat.No. : | PLA2G10-4485R |
Product Overview : | Recombinant Rat PLA2G10 Protein with Fc-tag was expressed in HEK293. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | Fc |
Description : | Enables phospholipase A2 activity. Predicted to be involved in several processes, including cholesterol homeostasis; glycerophospholipid metabolic process; and positive regulation of lipid localization. Predicted to act upstream of or within several processes, including cellular response to leukemia inhibitory factor; erythrocyte maturation; and negative regulation of cytokine production involved in inflammatory response. Predicted to be located in acrosomal vesicle and extracellular space. Orthologous to human PLA2G10 (phospholipase A2 group X). |
Molecular Mass : | The protein has a calculated MW of 40 kDa. |
AA Sequence : | GLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYYHDCCYSQAQDAGCSPKLYRYPWKCMDHRILCGPAENKCQELLCRCDETLAYCLADTEYHLKYLFFPSVLCEKDSPKCNPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.3 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
Gene Name | Pla2g10 phospholipase A2, group X [ Rattus norvegicus ] |
Official Symbol | PLA2G10 |
Synonyms | PLA2G10; phospholipase A2, group X; group 10 secretory phospholipase A2; GX sPLA2; group X phospholipase A2; phospholipase A2, group 10; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10; phosphatidylcholine 2-acylhydrolase GX; PLA2GX; sPLA2-X; |
Gene ID | 29359 |
mRNA Refseq | NM_017176 |
Protein Refseq | NP_058872 |
◆ Recombinant Proteins | ||
PLA2G10-30733TH | Recombinant Human PLA2G10, His-tagged | +Inquiry |
PLA2G10-4484R | Recombinant Rat PLA2G10 Protein | +Inquiry |
Pla2g10-4894M | Recombinant Mouse Pla2g10 Protein, Myc/DDK-tagged | +Inquiry |
Pla2g10-7844R | Recombinant Rat Pla2g10 protein, His&Myc-tagged | +Inquiry |
PLA2G10-4485R | Recombinant Rat PLA2G10 Protein, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G10-3145HCL | Recombinant Human PLA2G10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G10 Products
Required fields are marked with *
My Review for All PLA2G10 Products
Required fields are marked with *