Recombinant Rat PLA2G10 Protein, Fc tagged

Cat.No. : PLA2G10-4485R
Product Overview : Recombinant Rat PLA2G10 Protein with Fc-tag was expressed in HEK293.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : Fc
Description : Enables phospholipase A2 activity. Predicted to be involved in several processes, including cholesterol homeostasis; glycerophospholipid metabolic process; and positive regulation of lipid localization. Predicted to act upstream of or within several processes, including cellular response to leukemia inhibitory factor; erythrocyte maturation; and negative regulation of cytokine production involved in inflammatory response. Predicted to be located in acrosomal vesicle and extracellular space. Orthologous to human PLA2G10 (phospholipase A2 group X).
Molecular Mass : The protein has a calculated MW of 40 kDa.
AA Sequence : GLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYYHDCCYSQAQDAGCSPKLYRYPWKCMDHRILCGPAENKCQELLCRCDETLAYCLADTEYHLKYLFFPSVLCEKDSPKCNPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.3 mg/mL by BCA
Storage Buffer : Sterile PBS, pH 7.4
Gene Name Pla2g10 phospholipase A2, group X [ Rattus norvegicus ]
Official Symbol PLA2G10
Synonyms PLA2G10; phospholipase A2, group X; group 10 secretory phospholipase A2; GX sPLA2; group X phospholipase A2; phospholipase A2, group 10; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10; phosphatidylcholine 2-acylhydrolase GX; PLA2GX; sPLA2-X;
Gene ID 29359
mRNA Refseq NM_017176
Protein Refseq NP_058872

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLA2G10 Products

Required fields are marked with *

My Review for All PLA2G10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon