Recombinant Rat Pla2g15 protein, His&Myc-tagged
Cat.No. : | Pla2g15-434R |
Product Overview : | Recombinant Rat Pla2g15 protein(Q675A5)(34-413aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 34-413aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEMIEEMYQMYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQDIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP |
Gene Name | Pla2g15 phospholipase A2, group XV [ Rattus norvegicus ] |
Official Symbol | Pla2g15 |
Synonyms | PLA2G15; phospholipase A2, group XV; group XV phospholipase A2; lysophospholipase 3; 1-O-acylceramide synthase; lysosomal phospholipase A2; LCAT-like lysophospholipase; ACS; LLPL; LPLA2; Lypla3; MGC114208; 1-O-acylceramidesynthase; |
Gene ID | 361401 |
mRNA Refseq | NM_001004277 |
Protein Refseq | NP_001004277 |
◆ Recombinant Proteins | ||
Pla2g15-1945M | Recombinant Mouse Pla2g15 Protein, His-tagged | +Inquiry |
PLA2G15-4471D | Recombinant Dog PLA2G15 protein, His&Myc-tagged | +Inquiry |
PLA2G15-12885M | Recombinant Mouse PLA2G15 Protein | +Inquiry |
Pla2g15-4897M | Recombinant Mouse Pla2g15 Protein, Myc/DDK-tagged | +Inquiry |
PLA2G15-3453R | Recombinant Rhesus monkey PLA2G15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G15-3144HCL | Recombinant Human PLA2G15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pla2g15 Products
Required fields are marked with *
My Review for All Pla2g15 Products
Required fields are marked with *