Recombinant Rat PLA2G2A Protein (22-146 aa), His-tagged
Cat.No. : | PLA2G2A-1582R |
Product Overview : | Recombinant Rat PLA2G2A Protein (22-146 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 22-146 aa |
Description : | Thought to participate in the regulation of the phospholipid metabolism in biombranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.1 kDa |
AA Sequence : | SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Pla2g2a phospholipase A2, group IIA (platelets, synovial fluid) [ Rattus norvegicus ] |
Official Symbol | PLA2G2A |
Synonyms | PLA2G2A; group IIA phospholipase A2; sPLA2; |
Gene ID | 29692 |
mRNA Refseq | NM_031598 |
Protein Refseq | NP_113786 |
UniProt ID | P14423 |
◆ Recombinant Proteins | ||
PLA2G2A-3541H | Recombinant Human PLA2G2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PLA2G2A-6797M | Recombinant Mouse PLA2G2A Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G2A-669H | Active Recombinant Human PLA2G2A protein, His-tagged | +Inquiry |
PLA2G2A-12H | Active Recombinant Human PLA2G2A Protein (1-124; variant N1A) | +Inquiry |
PLA2G2A-12888M | Recombinant Mouse PLA2G2A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G2A-2184HCL | Recombinant Human PLA2G2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G2A Products
Required fields are marked with *
My Review for All PLA2G2A Products
Required fields are marked with *