Recombinant Rat Pla2g2a protein, His-SUMO-tagged
Cat.No. : | Pla2g2a-3880R |
Product Overview : | Recombinant Rat Pla2g2a protein(P14423)(22-146aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-146aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.1 kDa |
AA Sequence : | SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Pla2g2a phospholipase A2, group IIA (platelets, synovial fluid) [ Rattus norvegicus ] |
Official Symbol | Pla2g2a |
Synonyms | PLA2G2A; phospholipase A2, group IIA (platelets, synovial fluid); phospholipase A2, membrane associated; GIIC sPLA2; platelet phospholipase A2; group IIA phospholipase A2; eted enzyme type IIA phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A; sPLA2; |
Gene ID | 29692 |
mRNA Refseq | NM_031598 |
Protein Refseq | NP_113786 |
◆ Recombinant Proteins | ||
PLA2G2A-1031H | Recombinant Human PLA2G2A, His-tagged | +Inquiry |
PLA2G2A-4148R | Recombinant Rat PLA2G2A Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G2A-669H | Active Recombinant Human PLA2G2A protein, His-tagged | +Inquiry |
PLA2G2A-1885H | Recombinant Human PLA2G2A Protein, MYC/DDK-tagged | +Inquiry |
PLA2G2A-12888M | Recombinant Mouse PLA2G2A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G2A-2184HCL | Recombinant Human PLA2G2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pla2g2a Products
Required fields are marked with *
My Review for All Pla2g2a Products
Required fields are marked with *