Recombinant Rat Pla2g2a protein, His-SUMO-tagged

• Cat.No.: Pla2g2a-3880R
• Product Overview: Recombinant Rat Pla2g2a protein(P14423)(22-146aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 22-146aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.1 kDa
• AA Sequence: SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Pla2g2a phospholipase A2, group IIA (platelets, synovial fluid) [ Rattus norvegicus ]
• Official Symbol: Pla2g2a
• Synonyms: PLA2G2A; phospholipase A2, group IIA (platelets, synovial fluid); phospholipase A2, membrane associated; GIIC sPLA2; platelet phospholipase A2; group IIA phospholipase A2; eted enzyme type IIA phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A; sPLA2
• Gene ID: 29692
• mRNA Refseq: NM_031598
• Protein Refseq: NP_113786