Recombinant Rat PLAUR Protein (25-299 aa), His-tagged
Cat.No. : | PLAUR-726R |
Product Overview : | Recombinant Rat PLAUR Protein (25-299 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-299 aa |
Description : | Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 34.1 kDa |
AA Sequence : | LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Plaur plasminogen activator, urokinase receptor [ Rattus norvegicus ] |
Official Symbol | PLAUR |
Synonyms | PLAUR; U-PAR; Par; uPAR; Plaur3; uPAR-2; uPAR-3; |
Gene ID | 50692 |
mRNA Refseq | NM_017350 |
Protein Refseq | NP_059046 |
UniProt ID | P49616 |
◆ Recombinant Proteins | ||
Plaur-02HCL | Recombinant Mouse Plaur overexpression lysate | +Inquiry |
Plaur-831M | Active Recombinant Mouse Plaur protein, His&hFc-tagged | +Inquiry |
PLAUR-1574H | Recombinant Human PLAUR protein, His-Avi-tagged | +Inquiry |
PLAUR-0810H | Recombinant Human PLAUR protein, His-tagged | +Inquiry |
PLAUR-536C | Recombinant Cynomolgus Monkey PLAUR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAUR-1888HCL | Recombinant Human PLAUR cell lysate | +Inquiry |
PLAUR-2551MCL | Recombinant Mouse PLAUR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAUR Products
Required fields are marked with *
My Review for All PLAUR Products
Required fields are marked with *