Recombinant Rat PLAUR Protein (25-299 aa), His-tagged

Cat.No. : PLAUR-726R
Product Overview : Recombinant Rat PLAUR Protein (25-299 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 25-299 aa
Description : Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 34.1 kDa
AA Sequence : LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Plaur plasminogen activator, urokinase receptor [ Rattus norvegicus ]
Official Symbol PLAUR
Synonyms PLAUR; U-PAR; Par; uPAR; Plaur3; uPAR-2; uPAR-3;
Gene ID 50692
mRNA Refseq NM_017350
Protein Refseq NP_059046
UniProt ID P49616

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLAUR Products

Required fields are marked with *

My Review for All PLAUR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon