Recombinant Rat PRSS2 Protein (24-246 aa), His-tagged
Cat.No. : | PRSS2-2690R |
Product Overview : | Recombinant Rat PRSS2 Protein (24-246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-246 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.3 kDa |
AA Sequence : | IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Prss2 protease, serine, 2 [ Rattus norvegicus ] |
Official Symbol | PRSS2 |
Synonyms | PRSS2; anionic trypsin-2; pretrypsinogen II; serine protease 2; pancreatic trypsin II; Ptryss2; |
Gene ID | 25052 |
mRNA Refseq | NM_012729 |
Protein Refseq | NP_036861 |
UniProt ID | P00763 |
◆ Recombinant Proteins | ||
PRSS2-5408P | Recombinant Pig PRSS2 Protein (Asp20-Ser247), C-His tagged | +Inquiry |
PRSS2-30H | Active Recombinant Human PRSS2 Protein, His-tagged | +Inquiry |
PRSS2-316H | Recombinant Human Protease, Serine, 2 (Trypsin 2) , His-tagged | +Inquiry |
PRSS2-493P | Recombinant Pig PRSS2 Protein, His-tagged | +Inquiry |
PRSS2-3637R | Recombinant Rhesus monkey PRSS2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRSS2-2293MCL | Recombinant Mouse PRSS2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRSS2 Products
Required fields are marked with *
My Review for All PRSS2 Products
Required fields are marked with *
0
Inquiry Basket