Recombinant Rat PRSS2 Protein (24-246 aa), His-tagged
| Cat.No. : | PRSS2-2690R |
| Product Overview : | Recombinant Rat PRSS2 Protein (24-246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 24-246 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 25.3 kDa |
| AA Sequence : | IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Prss2 protease, serine, 2 [ Rattus norvegicus ] |
| Official Symbol | PRSS2 |
| Synonyms | PRSS2; anionic trypsin-2; pretrypsinogen II; serine protease 2; pancreatic trypsin II; Ptryss2; |
| Gene ID | 25052 |
| mRNA Refseq | NM_012729 |
| Protein Refseq | NP_036861 |
| UniProt ID | P00763 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRSS2 Products
Required fields are marked with *
My Review for All PRSS2 Products
Required fields are marked with *
