"PRSS2" Related Products

Expand
Expand

Recombinant Rat PRSS2 Protein (24-246 aa), His-tagged

Cat.No. : PRSS2-2690R
Product Overview : Recombinant Rat PRSS2 Protein (24-246 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.
Source : Yeast
Species : Rat
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 25.3 kDa
Protein length : 24-246 aa
AA Sequence : IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name : Prss2 protease, serine, 2 [ Rattus norvegicus ]
Official Symbol : PRSS2
Synonyms : PRSS2; anionic trypsin-2; pretrypsinogen II; serine protease 2; pancreatic trypsin II; Ptryss2;
Gene ID : 25052
mRNA Refseq : NM_012729
Protein Refseq : NP_036861
UniProt ID : P00763

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.