Recombinant Rat Reg3a protein, His-tagged
| Cat.No. : | Reg3a-3418R |
| Product Overview : | Recombinant Rat Reg3a protein(P35231)(26-174aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 26-174aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.5 kDa |
| AA Sequence : | EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Reg3a regenerating islet-derived 3 alpha [ Rattus norvegicus ] |
| Official Symbol | Reg3a |
| Synonyms | REG3A; regenerating islet-derived 3 alpha; regenerating islet-derived protein 3-alpha; REG 3; regIII; REG-3-alpha; reg III-alpha; lithostathine 3; pancreatitis-associated protein 2; islet of Langerhans regenerating protein 3; regenerating islet-derived protein 3 alpha; regenerating islet-derived protein III-alpha; Pap2; PapII; |
| Gene ID | 171162 |
| mRNA Refseq | NM_001145846 |
| Protein Refseq | NP_001139318 |
| ◆ Recombinant Proteins | ||
| REG3A-1340HFL | Recombinant Full Length Human REG3A Protein, C-Flag-tagged | +Inquiry |
| Reg3a-654M | Active Recombinant Mouse Reg3a | +Inquiry |
| REG3A-431H | Recombinant Human REG3A Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| REG3A-5886H | Recombinant Human REG3A Protein (Cys40-Asn164), N-His tagged | +Inquiry |
| REG3A-86H | Active Recombinant Human REG3A Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| REG3A-2691MCL | Recombinant Mouse REG3A cell lysate | +Inquiry |
| REG3A-2496HCL | Recombinant Human REG3A cell lysate | +Inquiry |
| REG3A-1326RCL | Recombinant Rat REG3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Reg3a Products
Required fields are marked with *
My Review for All Reg3a Products
Required fields are marked with *
