Recombinant Human REG3A Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | REG3A-431H |
Product Overview : | REG3A MS Standard C13 and N15-labeled recombinant protein (NP_002571) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Nov 2014] |
Molecular Mass : | 19.4 kDa |
AA Sequence : | MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | REG3A regenerating islet-derived 3 alpha [ Homo sapiens (human) ] |
Official Symbol | REG3A |
Synonyms | REG3A; regenerating islet-derived 3 alpha; pancreatitis associated protein, PAP; regenerating islet-derived protein 3-alpha; HIP; PAP1; PBCGF; REG III; REG3; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-pancreas; pancreatic beta cell growth factor; regenerating islet-derived protein III-alpha; PAP; PAP-H; REG-III; FLJ18565; |
Gene ID | 5068 |
mRNA Refseq | NM_002580 |
Protein Refseq | NP_002571 |
MIM | 167805 |
UniProt ID | Q06141 |
◆ Recombinant Proteins | ||
REG3A-3699H | Recombinant Human REG3A, His-tagged(Human) | +Inquiry |
REG3A-3417H | Recombinant Human REG3A protein, GST-tagged | +Inquiry |
REG3A-5414H | Recombinant Human REG3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Reg3a-438R | Active Recombinant Rat Reg3a, Met-tagged | +Inquiry |
REG3A-4988R | Recombinant Rat REG3A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3A-1326RCL | Recombinant Rat REG3A cell lysate | +Inquiry |
REG3A-2691MCL | Recombinant Mouse REG3A cell lysate | +Inquiry |
REG3A-2496HCL | Recombinant Human REG3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REG3A Products
Required fields are marked with *
My Review for All REG3A Products
Required fields are marked with *