Recombinant Rat REG3B Protein (27-175 aa), His-sumostar-tagged

Cat.No. : REG3B-2511R
Product Overview : Recombinant Rat REG3B Protein (27-175 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Yeast
Tag : His&SUMO
Protein Length : 27-175 aa
Description : Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 32.6 kDa
AA Sequence : EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Reg3b regenerating family member 3 beta [ Rattus norvegicus (Norway rat) ]
Official Symbol REG3B
Synonyms Reg3b; Pap; Pap1;
Gene ID 24618
mRNA Refseq NM_053289
Protein Refseq NP_445741
UniProt ID P25031

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REG3B Products

Required fields are marked with *

My Review for All REG3B Products

Required fields are marked with *

0
cart-icon