Recombinant Rat REG3B Protein (27-175 aa), His-sumostar-tagged
Cat.No. : | REG3B-2511R |
Product Overview : | Recombinant Rat REG3B Protein (27-175 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His&SUMO |
Protein Length : | 27-175 aa |
Description : | Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 32.6 kDa |
AA Sequence : | EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Reg3b regenerating family member 3 beta [ Rattus norvegicus (Norway rat) ] |
Official Symbol | REG3B |
Synonyms | Reg3b; Pap; Pap1; |
Gene ID | 24618 |
mRNA Refseq | NM_053289 |
Protein Refseq | NP_445741 |
UniProt ID | P25031 |
◆ Recombinant Proteins | ||
REG3B-2511R | Recombinant Rat REG3B Protein (27-175 aa), His-sumostar-tagged | +Inquiry |
Reg3b-1793M | Recombinant Mouse Reg3b protein, His-tagged | +Inquiry |
Reg3b-323M | Recombinant Mouse Reg3b, His tagged | +Inquiry |
Reg3b-3943R | Recombinant Rat Reg3b protein, His-tagged | +Inquiry |
Reg3b-1794R | Recombinant Rat Reg3b protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3B-999MCL | Recombinant Mouse REG3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REG3B Products
Required fields are marked with *
My Review for All REG3B Products
Required fields are marked with *