Recombinant Rat Retn protein
Cat.No. : | Retn-1056R |
Product Overview : | Recombinant Rat Retn protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 95 |
Description : | May contribute to impaired glucose tolerance and inhibition of adipocyte differentiation. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH7.4, with 0.02 % Tween-20. |
Molecular Mass : | Approximately 20.2 kDa, a disulfide-linked homodimer consisting of two 95 amino acid polypeptide chains. |
AA Sequence : | MPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS |
Endotoxin : | Less than 0.1 EU/μg of rRtResistin as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Retn |
Official Symbol | Retn |
Synonyms | RETN; resistin; |
Gene ID | 246250 |
mRNA Refseq | NM_144741 |
Protein Refseq | NP_653342 |
UniProt ID | Q8K4J7 |
◆ Recombinant Proteins | ||
RETN-61H | Active Recombinant Human RETN Protein, His-tagged | +Inquiry |
RETN-3424H | Recombinant Human RETN protein, His-SUMO-tagged | +Inquiry |
RETN-874M | Recombinant Mouse RETN protein, hFc-tagged | +Inquiry |
RETN-761H | Recombinant Human RETN | +Inquiry |
RETN-197H | Recombinant Human RETN protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Retn Products
Required fields are marked with *
My Review for All Retn Products
Required fields are marked with *
0
Inquiry Basket