Recombinant Rat Retn protein

Species :	Rat
Source :	E.coli
Tag :	Non
Protein Length :	95
Description :	May contribute to impaired glucose tolerance and inhibition of adipocyte differentiation.
Form :	Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH7.4, with 0.02 % Tween-20.
Molecular Mass :	Approximately 20.2 kDa, a disulfide-linked homodimer consisting of two 95 amino acid polypeptide chains.
AA Sequence :	MPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS
Endotoxin :	Less than 0.1 EU/μg of rRtResistin as determined by LAL method.
Purity :	>97% by SDS-PAGE and HPLC analysis.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.