Recombinant Rat Retn protein

Cat.No. : Retn-1056R
Product Overview : Recombinant Rat Retn protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 95
Description : May contribute to impaired glucose tolerance and inhibition of adipocyte differentiation.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH7.4, with 0.02 % Tween-20.
Molecular Mass : Approximately 20.2 kDa, a disulfide-linked homodimer consisting of two 95 amino acid polypeptide chains.
AA Sequence : MPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS
Endotoxin : Less than 0.1 EU/μg of rRtResistin as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Retn
Official Symbol Retn
Synonyms RETN; resistin;
Gene ID 246250
mRNA Refseq NM_144741
Protein Refseq NP_653342
UniProt ID Q8K4J7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Retn Products

Required fields are marked with *

My Review for All Retn Products

Required fields are marked with *

0
cart-icon