Recombinant Rat SERPINA1 Protein (25-411 aa), His-tagged
Cat.No. : | SERPINA1-1514R |
Product Overview : | Recombinant Rat SERPINA1 Protein (25-411 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 25-411 aa |
Description : | Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 45.7 kDa |
AA Sequence : | EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Serpina1 serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 [ Rattus norvegicus ] |
Official Symbol | SERPINA1 |
Synonyms | SERPINA1; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; |
Gene ID | 116807 |
UniProt ID | P17475 |
◆ Recombinant Proteins | ||
SERPINA1-1278H | Active Recombinant Human SERPINA1 protein, His-tagged | +Inquiry |
SERPINA1-3964R | Recombinant Rhesus Macaque SERPINA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA1-256H | Recombinant Horse SERPINA1 protein, His-tagged | +Inquiry |
SERPINA1-1841H | Recombinant Human SERPINA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINA1-1514R | Recombinant Rat SERPINA1 Protein (25-411 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
SERPINA1-P035H | Native Human alpha-1 proteinase inhibitor therapeutic protein (Aralast, Aralast NP, Glassia, Prolastin, Prolastin-C, Zemaira) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA1-2856HCL | Recombinant Human SERPINA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINA1 Products
Required fields are marked with *
My Review for All SERPINA1 Products
Required fields are marked with *
0
Inquiry Basket