Recombinant Rat Serpina1 protein, His-SUMO-tagged
Cat.No. : | Serpina1-3479R |
Product Overview : | Recombinant Rat Serpina1 protein(P17475)(25-411aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-411aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 59.7 kDa |
AA Sequence : | EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Serpina1 serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 [ Rattus norvegicus ] |
Official Symbol | Serpina1 |
Synonyms | SERPINA1; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; |
Gene ID | 116807 |
◆ Recombinant Proteins | ||
SERPINA1-866H | Recombinant Human SERPINA1 Protein, MYC/DDK-tagged | +Inquiry |
SERPINA1-1841H | Recombinant Human SERPINA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINA1-4841Z | Recombinant Zebrafish SERPINA1 | +Inquiry |
SERPINA1-1119R | Recombinant Rat SERPINA1 Protein, His-tagged | +Inquiry |
SERPINA1-0609H | Recombinant Human SERPINA1 Protein (Glu25-Lys418), N-His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA1-P035H | Native Human alpha-1 proteinase inhibitor therapeutic protein (Aralast, Aralast NP, Glassia, Prolastin, Prolastin-C, Zemaira) | +Inquiry |
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA1-2856HCL | Recombinant Human SERPINA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Serpina1 Products
Required fields are marked with *
My Review for All Serpina1 Products
Required fields are marked with *