Recombinant Rat Slc2a1 protein(207-271aa), His&Myc-tagged

• Cat.No.: Slc2a1-4110R
• Product Overview: Recombinant Rat Slc2a1 protein(P11167)(207-271aa), fused with N-terminal His&C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&Myc
• Protein Length: 207-271aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 15.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: CPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREKKVTILELFRSPAYRQP

Gene Information

• Gene Name: Slc2a1 solute carrier family 2 (facilitated glucose transporter), member 1 [ Rattus norvegicus ]
• Official Symbol: Slc2a1
• Synonyms: SLC2A1; solute carrier family 2 (facilitated glucose transporter), member 1; solute carrier family 2, facilitated glucose transporter member 1; GLUT-1; solute carrier family 2, member 1; glucose transporter type 1, erythrocyte/brain; Solute carrier family 2 a 1 (facilitated glucose transporter) brain; GTG1; Gtg3; GLUTB; Glut1; RATGTG1
• Gene ID: 24778
• mRNA Refseq: NM_138827
• Protein Refseq: NP_620182