Recombinant Rat Slc2a1 protein(207-271aa), His&Myc-tagged
Cat.No. : | Slc2a1-4110R |
Product Overview : | Recombinant Rat Slc2a1 protein(P11167)(207-271aa), fused with N-terminal His&C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 207-271aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREKKVTILELFRSPAYRQP |
Gene Name | Slc2a1 solute carrier family 2 (facilitated glucose transporter), member 1 [ Rattus norvegicus ] |
Official Symbol | Slc2a1 |
Synonyms | SLC2A1; solute carrier family 2 (facilitated glucose transporter), member 1; solute carrier family 2, facilitated glucose transporter member 1; GLUT-1; solute carrier family 2, member 1; glucose transporter type 1, erythrocyte/brain; Solute carrier family 2 a 1 (facilitated glucose transporter) brain; GTG1; Gtg3; GLUTB; Glut1; RATGTG1; |
Gene ID | 24778 |
mRNA Refseq | NM_138827 |
Protein Refseq | NP_620182 |
◆ Recombinant Proteins | ||
SLC2A1-2741H | Recombinant Human SLC2A1, His-tagged | +Inquiry |
SLC2A1-1754H | Recombinant Human SLC2A1 protein, His-SUMO-tagged | +Inquiry |
Slc2a1-5948M | Recombinant Mouse Slc2a1 protein | +Inquiry |
SLC2A1-3307M | Recombinant Mouse SLC2A1 protein, His-SUMO-tagged | +Inquiry |
SLC2A1-07HCL | Recombinant Human SLC2A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc2a1 Products
Required fields are marked with *
My Review for All Slc2a1 Products
Required fields are marked with *