Recombinant Rat Socs3 protein, His-SUMO-tagged
Cat.No. : | Socs3-3515R |
Product Overview : | Recombinant Rat Socs3 protein(O88583)(1-225aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-225aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Socs3 suppressor of cytokine signaling 3 [ Rattus norvegicus ] |
Official Symbol | Socs3 |
Synonyms | SOCS3; suppressor of cytokine signaling 3; cytokine-inducible SH2 protein 3; cytokine inducible SH2-containing protein 3; Cish3; Ssi-3; Socs-3; |
Gene ID | 89829 |
mRNA Refseq | NM_053565 |
Protein Refseq | NP_446017 |
◆ Recombinant Proteins | ||
SOCS3-6938H | Recombinant Human Suppressor Of Cytokine Signaling 3, GST-tagged | +Inquiry |
Socs3-26M | Recombinant Mouse Socs3 protein, His-tagged | +Inquiry |
Socs3-892M | Recombinant Mouse Socs3 Protein, MYC/DDK-tagged | +Inquiry |
SOCS3-6682H | Recombinant Human SOCS3 Protein (Met1-Leu225), N-His tagged | +Inquiry |
SOCS3-6941H | Recombinant Human Suppressor Of Cytokine Signaling 3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOCS3-1580HCL | Recombinant Human SOCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Socs3 Products
Required fields are marked with *
My Review for All Socs3 Products
Required fields are marked with *
0
Inquiry Basket