Recombinant Rat Socs3 protein, His-SUMO-tagged
| Cat.No. : | Socs3-3515R |
| Product Overview : | Recombinant Rat Socs3 protein(O88583)(1-225aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-225aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.8 kDa |
| AA Sequence : | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Socs3 suppressor of cytokine signaling 3 [ Rattus norvegicus ] |
| Official Symbol | Socs3 |
| Synonyms | SOCS3; suppressor of cytokine signaling 3; cytokine-inducible SH2 protein 3; cytokine inducible SH2-containing protein 3; Cish3; Ssi-3; Socs-3; |
| Gene ID | 89829 |
| mRNA Refseq | NM_053565 |
| Protein Refseq | NP_446017 |
| ◆ Recombinant Proteins | ||
| Socs3-26M | Recombinant Mouse Socs3 protein, His-tagged | +Inquiry |
| SOCS3-6939H | Recombinant Human Suppressor Of Cytokine Signaling 3, His-tagged | +Inquiry |
| SOCS3-4218R | Recombinant Rhesus Macaque SOCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOCS3-1526R | Recombinant Rat SOCS3 Protein (1-225 aa), His-tagged | +Inquiry |
| SOCS3-6938H | Recombinant Human Suppressor Of Cytokine Signaling 3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOCS3-1580HCL | Recombinant Human SOCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Socs3 Products
Required fields are marked with *
My Review for All Socs3 Products
Required fields are marked with *
