Recombinant Rat Sort1 Protein, His-SUMO-tagged
| Cat.No. : | Sort1-1374R |
| Product Overview : | Recombinant Rat Sort1 Protein (610-754aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 610-754 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 32.5 kDa |
| AA Sequence : | CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFR PENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQN SKSSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Sort1 sortilin 1 [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | Sort1 |
| Synonyms | Nt3; Nts3; NTR3; glycoprotein 110; gp110; neurotensin receptor 3 |
| Gene ID | 83576 |
| mRNA Refseq | NM_031767.1 |
| Protein Refseq | NP_113955.1 |
| UniProt ID | O54861 |
| ◆ Recombinant Proteins | ||
| SORT1-15H | Active Recombinant Human Neurotensin Receptor 3/Sortilin | +Inquiry |
| SORT1-5331R | Recombinant Rat SORT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SORT1-0722H | Recombinant Human SORT1 protein, His-tagged | +Inquiry |
| SORT1-6212H | Recombinant Human SORT1 Protein (Trp50-Asp320), N-GST tagged | +Inquiry |
| SORT1-2879H | Recombinant Human SORT1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SORT1-493HKCL | Human SORT1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sort1 Products
Required fields are marked with *
My Review for All Sort1 Products
Required fields are marked with *



