Recombinant Rat SOST Protein (29-213 aa), His-Myc-tagged
| Cat.No. : | SOST-2669R |
| Product Overview : | Recombinant Rat SOST Protein (29-213 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Stem Cells. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 29-213 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 28.0 kDa |
| AA Sequence : | FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Sost sclerostin [ Rattus norvegicus ] |
| Official Symbol | SOST |
| Synonyms | SOST; sclerostin; sclerosteosis; |
| Gene ID | 80722 |
| mRNA Refseq | NM_030584 |
| Protein Refseq | NP_085073 |
| UniProt ID | Q99P67 |
| ◆ Recombinant Proteins | ||
| SOST-925H | Active Recombinant Human SOST, His-tagged | +Inquiry |
| SOST-2880H | Recombinant Human SOST, His-tagged | +Inquiry |
| SOST-1638C | Recombinant Cynomolgus SOST protein, His-tagged | +Inquiry |
| SOST-4410R | Recombinant Rhesus monkey SOST Protein, His-tagged | +Inquiry |
| Sost-8122M | Recombinant Mouse Sost protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOST-2846HCL | Recombinant Human SOST cell lysate | +Inquiry |
| SOST-2251RCL | Recombinant Rat SOST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOST Products
Required fields are marked with *
My Review for All SOST Products
Required fields are marked with *
