Recombinant Rat SOST Protein (29-213 aa), His-Myc-tagged

Cat.No. : SOST-2669R
Product Overview : Recombinant Rat SOST Protein (29-213 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Stem Cells. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&Myc
Protein Length : 29-213 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.0 kDa
AA Sequence : FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Sost sclerostin [ Rattus norvegicus ]
Official Symbol SOST
Synonyms SOST; sclerostin; sclerosteosis;
Gene ID 80722
mRNA Refseq NM_030584
Protein Refseq NP_085073
UniProt ID Q99P67

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOST Products

Required fields are marked with *

My Review for All SOST Products

Required fields are marked with *

0

Inquiry Basket

cartIcon