Recombinant Rat Sost protein, His&Myc-tagged
Cat.No. : | Sost-4568R |
Product Overview : | Recombinant Rat Sost protein(Q99P67)(29-213aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 29-213aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Sost sclerostin [ Rattus norvegicus ] |
Official Symbol | Sost |
Synonyms | SOST; sclerostin; sclerosteosis; |
Gene ID | 80722 |
mRNA Refseq | NM_030584 |
Protein Refseq | NP_085073 |
◆ Recombinant Proteins | ||
SOST-5673R | Recombinant Rat SOST Protein | +Inquiry |
Sost-4567R | Recombinant Rat Sost protein, hFc-tagged | +Inquiry |
SOST-5332R | Recombinant Rat SOST Protein, His (Fc)-Avi-tagged | +Inquiry |
SOST-5888H | Recombinant Human SOST Protein (Gln24-Tyr213), N-His and SUMO tagged | +Inquiry |
Sost-8577M | Recombinant Mouse Sost Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOST-2251RCL | Recombinant Rat SOST cell lysate | +Inquiry |
SOST-2846HCL | Recombinant Human SOST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sost Products
Required fields are marked with *
My Review for All Sost Products
Required fields are marked with *