Recombinant Rat Syngr1 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Syngr1-1034R |
| Product Overview : | Recombinant Rat Syngr1 protein(Q62876)(1-234aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-234aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.7 kDa |
| AA Sequence : | MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWVFSIVVFGSIVNEGYLNNPEEEEEFCIYNRNPNACSYGVTVGVLAFLTCLVYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFFWFVGFCFLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWAGQAVLAFQRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPSAGSDPTGMGGTYQHPANAFDAEPQGYQSQGY |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Recombinant Proteins | ||
| SYNGR1-5866R | Recombinant Rat SYNGR1 Protein | +Inquiry |
| RFL30932HF | Recombinant Full Length Human Synaptogyrin-1(Syngr1) Protein, His-Tagged | +Inquiry |
| RFL24623MF | Recombinant Full Length Mouse Synaptogyrin-1(Syngr1) Protein, His-Tagged | +Inquiry |
| Syngr1-1034R | Recombinant Rat Syngr1 Full Length Transmembrane protein, His-tagged | +Inquiry |
| SYNGR1-3300H | Recombinant Human SYNGR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SYNGR1-1318HCL | Recombinant Human SYNGR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Syngr1 Products
Required fields are marked with *
My Review for All Syngr1 Products
Required fields are marked with *
