Recombinant Rat TG Protein (21-300 aa), His-SUMO-tagged

• Cat.No.: TG-2112R
• Product Overview: Recombinant Rat TG Protein (21-300 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 21-300 aa
• Description: Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 48.0 kDa
• AA Sequence: NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Tg thyroglobulin [ Rattus norvegicus ]
• Official Symbol: TG
• Synonyms: TG; thyroglobulin; Tgn
• Gene ID: 24826
• mRNA Refseq: NM_030988
• Protein Refseq: NP_112250
• UniProt ID: P06882