Recombinant Rat TG Protein (21-300 aa), His-SUMO-tagged
Cat.No. : | TG-2112R |
Product Overview : | Recombinant Rat TG Protein (21-300 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-300 aa |
Description : | Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 48.0 kDa |
AA Sequence : | NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Tg thyroglobulin [ Rattus norvegicus ] |
Official Symbol | TG |
Synonyms | TG; thyroglobulin; Tgn; |
Gene ID | 24826 |
mRNA Refseq | NM_030988 |
Protein Refseq | NP_112250 |
UniProt ID | P06882 |
◆ Recombinant Proteins | ||
TG-708H | Recombinant Human TG Protein, MYC/DDK-tagged | +Inquiry |
TG-16699M | Recombinant Mouse TG Protein | +Inquiry |
TG-6336H | Recombinant Human TG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tg-2125R | Recombinant Rat Tg Protein, His-tagged | +Inquiry |
Tg-500M | Recombinant Mouse Tg Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
TG-121B | Native Bovine TG | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
TG-37P | Native Porcine TG protein | +Inquiry |
TG-393H | Native Human Thyroglobulin | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TG Products
Required fields are marked with *
My Review for All TG Products
Required fields are marked with *
0
Inquiry Basket