Recombinant Rat TG Protein (21-300 aa), His-SUMO-tagged

Cat.No. : TG-2112R
Product Overview : Recombinant Rat TG Protein (21-300 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 21-300 aa
Description : Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 48.0 kDa
AA Sequence : NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Tg thyroglobulin [ Rattus norvegicus ]
Official Symbol TG
Synonyms TG; thyroglobulin; Tgn;
Gene ID 24826
mRNA Refseq NM_030988
Protein Refseq NP_112250
UniProt ID P06882

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TG Products

Required fields are marked with *

My Review for All TG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon