Recombinant Rat TG Protein (21-300 aa), His-SUMO-tagged
| Cat.No. : | TG-2112R |
| Product Overview : | Recombinant Rat TG Protein (21-300 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 21-300 aa |
| Description : | Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 48.0 kDa |
| AA Sequence : | NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Tg thyroglobulin [ Rattus norvegicus ] |
| Official Symbol | TG |
| Synonyms | TG; thyroglobulin; Tgn; |
| Gene ID | 24826 |
| mRNA Refseq | NM_030988 |
| Protein Refseq | NP_112250 |
| UniProt ID | P06882 |
| ◆ Recombinant Proteins | ||
| TG-8267H | Recombinant Human TG, GST-tagged | +Inquiry |
| Tg-2125R | Recombinant Rat Tg Protein, His-tagged | +Inquiry |
| TG-0056H | Recombinant Human TG Protein | +Inquiry |
| TG-9158M | Recombinant Mouse TG Protein, His (Fc)-Avi-tagged | +Inquiry |
| TG-708H | Recombinant Human TG Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TG-31519TH | Native Human TG | +Inquiry |
| TG-37P | Native Porcine TG protein | +Inquiry |
| TG-393H | Native Human Thyroglobulin | +Inquiry |
| TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
| TG-121B | Native Bovine TG | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TG Products
Required fields are marked with *
My Review for All TG Products
Required fields are marked with *
