Recombinant Rat Tgfb1 Protein, His-SUMO-tagged
| Cat.No. : | Tgfb1-1384R |
| Product Overview : | Recombinant Rat Tgfb1 Protein (30-278aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 30-278 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 44.5 kDa |
| AA Sequence : | LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEP EADYYAKEVTRVLMVDRNNAIYDKTKDITHSIYMFFNTSDIREAVPEPPLLSRAELRLQRFKSTVEQHVE LYQKYSNNSWRYLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNVLHVEINGI SPKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Tgfb1 transforming growth factor, beta 1 [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | Tgfb1 |
| Synonyms | Tgfb1; Tgfb |
| Gene ID | 59086 |
| mRNA Refseq | NM_021578.2 |
| Protein Refseq | NP_067589.1 |
| UniProt ID | P17246 |
| ◆ Recombinant Proteins | ||
| TGFB1-908H | Recombinant Human Transforming Growth Factor, Beta 1, His-tagged | +Inquiry |
| TGFB1-199P | Active Recombinant Pig TGFB1 Protein (Ala279-Ser390), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| Tgfb1-7348M | Active Recombinant Mouse Tgfb1 protein, His-tagged | +Inquiry |
| TGFB1-3754H | Recombinant Human TGFB1 protein | +Inquiry |
| TGFB1-014H | Active Recombinant Human TGFB1 Protein | +Inquiry |
| ◆ Native Proteins | ||
| TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
| TGFB1-445HKCL | Human TGFB1 Knockdown Cell Lysate | +Inquiry |
| TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
| TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
| TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tgfb1 Products
Required fields are marked with *
My Review for All Tgfb1 Products
Required fields are marked with *
