"Tgfb1" Related Products

Expand
Expand

Recombinant Rat Tgfb1 Protein, His-SUMO-tagged

Cat.No.: Tgfb1-1384R
Product Overview: Recombinant Rat Tgfb1 Protein (30-278aa) was expressed in E. coli with N-terminal His-SUMO tag.
Source: E. coli
Species: Rat
Tag : His-SUMO
Form: Tris-based buffer, 50% glycerol.
Molecular Mass: 44.5 kDa
AA Sequence: LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEP
EADYYAKEVTRVLMVDRNNAIYDKTKDITHSIYMFFNTSDIREAVPEPPLLSRAELRLQRFKSTVEQHVE
LYQKYSNNSWRYLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNVLHVEINGI
SPKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRR
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name: Tgfb1 transforming growth factor, beta 1 [ Rattus norvegicus (Norway rat) ]
Official Symbol: Tgfb1
Synonyms: Tgfb1; Tgfb
Gene ID: 59086
mRNA Refseq: NM_021578.2
Protein Refseq: NP_067589.1
UniProt ID: P17246

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.