Recombinant Rat Tgfbr2 protein, His&Myc-tagged
| Cat.No. : | Tgfbr2-3573R |
| Product Overview : | Recombinant Rat Tgfbr2 protein(P38438)(24-166aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 24-166aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.0 kDa |
| AA Sequence : | IPPHVPKSVNSDLMAGDNSGAVKLPQLCKFCDVTLSTCDNQKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKRAGETFFMCSCNTEECNDYIIFNEEYTTSSPDLLLVIIQ |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Tgfbr2 transforming growth factor, beta receptor II [ Rattus norvegicus ] |
| Official Symbol | Tgfbr2 |
| Synonyms | TGFBR2; transforming growth factor, beta receptor II; TGF-beta receptor type-2; TGFR-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; transforming growth factor beta, receptor 2; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor beta receptor type II; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor; Tgfbr2T; TGF-beta 2; |
| Gene ID | 81810 |
| mRNA Refseq | NM_031132 |
| Protein Refseq | NP_112394 |
| ◆ Recombinant Proteins | ||
| TGFBR2-209H | Recombinant Human TGFBR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TGFBR2-6979C | Recombinant Chicken TGFBR2 | +Inquiry |
| TGFBR2-2184H | Recombinant Human TGFBR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TGFBR2-6039R | Recombinant Rat TGFBR2 Protein | +Inquiry |
| Tgfbr2-6817M | Active Recombinant Mouse Tgfbr2 Protein(Ile24-Asp159), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
| TGFBR2-1291CCL | Recombinant Cynomolgus TGFBR2 cell lysate | +Inquiry |
| TGFBR2-1374RCL | Recombinant Rat TGFBR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tgfbr2 Products
Required fields are marked with *
My Review for All Tgfbr2 Products
Required fields are marked with *
