Recombinant Rat Tnf protein
Cat.No. : | Tnf-71R |
Product Overview : | Recombinant Rat Tnf protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 156 |
Description : | Tumor necrosis factor alpha (TNF-α), also called cachectin, is the best-know member of the TNF-family, which can cause cell death. This protein is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. TNF-α occurs as a secreted, soluble form and as a membrane-anchored form, both of which are biologically active. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. Two types of receptors for TNF-α have been described and virtually all cell types studied show the presence of one or both of these receptor types. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.2, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg in the presence of actinomycin D. |
Molecular Mass : | Approximately 17.2 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids. |
AA Sequence : | LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL |
Endotoxin : | Less than 1 EU/μg of rRtTNF-α as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Tnf |
Official Symbol | Tnf |
Synonyms | Tumor Necrosis Factor, TNFSF2, Cachectin, Differentiation-inducing Factor , DIF, Necrosin, Cytotoxin |
Gene ID | 24835 |
mRNA Refseq | NM_012675 |
Protein Refseq | NP_036807 |
UniProt ID | P16599 |
◆ Recombinant Proteins | ||
Tnf-381R | Active Recombinant Rat Tnf | +Inquiry |
TNF-154H | Active Recombinant Human TNF protein | +Inquiry |
TNF-307H | Recombinant Active Human TNF Protein, His-tagged(C-ter) | +Inquiry |
TNF-97R | Recombinant Rat TNF, Flag-tagged | +Inquiry |
Tnf-308P | Active Recombinant Guinea Pig Tnf | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnf Products
Required fields are marked with *
My Review for All Tnf Products
Required fields are marked with *
0
Inquiry Basket