Recombinant Rat Tnfsf13 Protein
| Cat.No. : | Tnfsf13-16R |
| Product Overview : | Rat APRIL was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Yeast |
| Description : | Tumor necrosis factor ligand superfamily member 13 (TNFSF13) also known as a proliferation-inducing ligand (APRIL) is a member of the tumor necrosis factor ligand (TNF) ligand family. |
| Molecular Mass : | 16.4 kDa |
| AA Sequence : | AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL(146) |
| Applications : | Cell culture, as an ELISA Standard, and as a Western Blot Control. |
| Gene Name | Tnfsf13 TNF superfamily member 13 [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | Tnfsf13 |
| Synonyms | Tnfsf13; TNF superfamily member 13; April; Tnlg7b; tumor necrosis factor ligand superfamily member 13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand 7b; tumor necrosis factor superfamily member 13 |
| Gene ID | 287437 |
| mRNA Refseq | NM_001009623 |
| Protein Refseq | NP_001009623 |
| UniProt ID | Q5PQL1 |
| ◆ Recombinant Proteins | ||
| TNFSF13-26H | Active Recombinant Human TNFSF13 protein, His-Flag-tagged | +Inquiry |
| TNFSF13-7565H | Recombinant Human TNFSF13 protein, His-Flag-tagged | +Inquiry |
| TNFSF13-2091H | Recombinant Human TNFSF13, FLAG-tagged | +Inquiry |
| TNFSF13-1480H | Recombinant Human TNFSF13 Protein (Met1-Leu250), N-His tagged | +Inquiry |
| Tnfsf13-936M | Recombinant Mouse Tnfsf13, Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF13-1346MCL | Recombinant Mouse TNFSF13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfsf13 Products
Required fields are marked with *
My Review for All Tnfsf13 Products
Required fields are marked with *
