Recombinant Rat Tnfsf13 Protein

Cat.No. : Tnfsf13-16R
Product Overview : Rat APRIL was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : Yeast
Description : Tumor necrosis factor ligand superfamily member 13 (TNFSF13) also known as a proliferation-inducing ligand (APRIL) is a member of the tumor necrosis factor ligand (TNF) ligand family.
Molecular Mass : 16.4 kDa
AA Sequence : AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL(146)
Applications : Cell culture, as an ELISA Standard, and as a Western Blot Control.
Gene Name Tnfsf13 TNF superfamily member 13 [ Rattus norvegicus (Norway rat) ]
Official Symbol Tnfsf13
Synonyms Tnfsf13; TNF superfamily member 13; April; Tnlg7b; tumor necrosis factor ligand superfamily member 13; tumor necrosis factor (ligand) superfamily, member 13; tumor necrosis factor ligand 7b; tumor necrosis factor superfamily member 13
Gene ID 287437
mRNA Refseq NM_001009623
Protein Refseq NP_001009623
UniProt ID Q5PQL1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfsf13 Products

Required fields are marked with *

My Review for All Tnfsf13 Products

Required fields are marked with *

0
cart-icon
0
compare icon