Recombinant Rat Vegfa protein

Cat.No. : Vegfa-44R
Product Overview : Recombinant Rat Vegfa protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 165
Description : Vascular Endothelial Growth Factor is a sub-family of growth factors produced by cells, which stimulates vasculogenesis and angiogenesis. VEGF's normal function is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. Mouse and rat express alternately spliced isoforms of 120, 164, and 188 amino acids (a.a.) in length. Recombinant Rat VEGF165 contains 165 amino acids residues (with an met at N- terminal) and it is a disulfide-linked homodimer. In addition, it shares 97 % a.a. sequence identity with corresponding regions of mouse, 88 % with human and bovine, 89 % with porcine and canine, and 90 % with feline and equine VEGF, respectively.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 300 mM NaCl, pH 8.8.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human umbilical vein endothelial cells(HUVEC) is less than 5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 38.7 kDa, a disulfide-linked homodimeric protein, consisting of two 165 amino acid polypeptide chains with Met at N-terminus.
AA Sequence : MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin : Less than 1 EU/μg of rRtVEGF164 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Vegfa
Official Symbol Vegfa
Synonyms VPF
Gene ID 83785
mRNA Refseq NM_001110333
Protein Refseq NP_001103803
UniProt ID P16612

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Vegfa Products

Required fields are marked with *

My Review for All Vegfa Products

Required fields are marked with *

0
cart-icon
0
compare icon