Recombinant Rhesus CCL11 protein

Cat.No. : CCL11-221R
Product Overview : Recombinant Rhesus CCL11 protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : Non
Protein Length : 74
Description : In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 6.9.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration range of 0.1-10.0 ng/ml.
Molecular Mass : Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
AA Sequence : GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP
Endotoxin : Less than 0.1 EU/μg of rRhEotaxin/CCL11 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL11
Official Symbol CCL11
Synonyms SCYA11; Eotaxin
Gene ID 574218
mRNA Refseq NM_001032874.1
Protein Refseq NP_001028046.1
UniProt ID Q8MIT7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL11 Products

Required fields are marked with *

My Review for All CCL11 Products

Required fields are marked with *

0
cart-icon
0
compare icon