| Species : |
Rhesus macaque |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
74 |
| Description : |
In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3. |
| Form : |
Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 6.9. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration range of 0.1-10.0 ng/ml. |
| Molecular Mass : |
Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids. |
| AA Sequence : |
GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP |
| Endotoxin : |
Less than 0.1 EU/μg of rRhEotaxin/CCL11 as determined by LAL method. |
| Purity : |
>98% by SDS-PAGE and HPLC analyses. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
