Recombinant Rhesus CCL11 protein
Cat.No. : | CCL11-221R |
Product Overview : | Recombinant Rhesus CCL11 protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | Non |
Protein Length : | 74 |
Description : | In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3. |
Form : | Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 6.9. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration range of 0.1-10.0 ng/ml. |
Molecular Mass : | Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : | GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP |
Endotoxin : | Less than 0.1 EU/μg of rRhEotaxin/CCL11 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL11 |
Official Symbol | CCL11 |
Synonyms | SCYA11; Eotaxin |
Gene ID | 574218 |
mRNA Refseq | NM_001032874.1 |
Protein Refseq | NP_001028046.1 |
UniProt ID | Q8MIT7 |
◆ Recombinant Proteins | ||
CCL11-58H | Recombinant Human CCL11 Protein, Biotin-tagged | +Inquiry |
Ccl11-636R | Recombinant Rat Ccl11 protein | +Inquiry |
CCL11-595H | Recombinant Human CCL11 protein, His & GST-tagged | +Inquiry |
CCL11-594H | Recombinant Horse CCL11 protein, His & GST-tagged | +Inquiry |
CCL11-3903H | Recombinant Human CCL11 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL11-7735HCL | Recombinant Human CCL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL11 Products
Required fields are marked with *
My Review for All CCL11 Products
Required fields are marked with *
0
Inquiry Basket