Species : |
Rhesus macaque |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
68 |
Description : |
Chemokine (C-C motif) ligand 5 (CCL5) also known as RANTES is classified as a chemotactic cytokine or chemokine. It is encoded by the CCL5 gene in humans. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites which has been reported to be produced by renal tubular epithelium, synovial fibroblasts and selected tumor cells. It also induces the proliferation and activation of certain natural-killer cells to form CHAK cells. Recombinant Rhesus Macaque CCL5 contains 68 amino acids and it shares 97% a.a. sequence identity with human CCL5. |
Form : |
Lyophilized from a 0.2 µm filtered solution in 20mM PB, pH 6.0, 500mM NaCl. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 1.0-10 ng/ml. |
Molecular Mass : |
Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids. |
AA Sequence : |
SPHASDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Endotoxin : |
Less than 0.1 EU/μg of rRhRANTES/CCL5 as determined by LAL method. |
Purity : |
>98% by SDS-PAGE and HPLC analyses. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |