Recombinant Rhesus macaque IL10 protein, C-terminal 10xHis-tagged-tagged
| Cat.No. : | IL10-2232R | 
| Product Overview : | Recombinant Rhesus macaque IL10 protein(P51496)(19-178aa), fused to C-terminal His tag, was expressed in Insect Cell. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus macaque | 
| Source : | Insect Cells | 
| Tag : | His | 
| Protein Length : | 19-178aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 21.2 kDa | 
| AA Sequence : | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| ◆ Recombinant Proteins | ||
| IL10-5436B | Recombinant Bovine IL10 protein, His-tagged | +Inquiry | 
| IL10-22R | Recombinant Rhesus macaque IL10 Protein, His-tagged | +Inquiry | 
| IL10-02H | Active Recombinant Human IL10 Protein, His-Tagged | +Inquiry | 
| IL10-839H | Recombinant Human IL10 protein, His & T7-tagged | +Inquiry | 
| IL10-3090R | Recombinant Rhesus macaque IL10 protein, His-B2M-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            