Recombinant Rhesus macaque IL10 protein, DEEP1&His-tagged
Cat.No. : | IL10-4644R |
Product Overview : | Recombinant Rhesus macaque IL10 protein(P51496)(19-178aa), fused with N-terminal DEEP1 tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-178aa |
Tag : | N-DEEP1&C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
◆ Recombinant Proteins | ||
IL10-2232R | Recombinant Rhesus macaque IL10 protein, C-terminal 10xHis-tagged-tagged | +Inquiry |
Il10-18R | Recombinant Rat Il10 protein | +Inquiry |
IL10-994G | Recombinant Goat IL10 Protein, His-tagged | +Inquiry |
IL10-246C | Active Recombinant Chicken Interleukin 10 | +Inquiry |
IL10-2678R | Recombinant Rat IL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
0
Inquiry Basket