Recombinant Rhesus macaque IL10 Protein, His/Myc-tagged
Cat.No. : | IL10-23R |
Product Overview : | Recombinant Rhesus macaque IL10(19-178aa) fused with His tag at N-terminal and Myc tag at C-terminalwas expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 19-178aa |
Form : | Tris-based buffer, 50% glycerol |
AA Sequence : | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | IL10 interleukin 10 [ Macaca mulatta ] |
Official Symbol | IL10 |
Synonyms | CSIF; IL-10; cytokine synthesis inhibitory factor |
Gene ID | 694931 |
mRNA Refseq | NM_001044727 |
Protein Refseq | NP_001038192 |
UniProt ID | P51496 |
◆ Recombinant Proteins | ||
IL10-3090R | Recombinant Rhesus macaque IL10 protein, His-B2M-tagged | +Inquiry |
IL10-001M | Active Recombinant Mouse IL10, MIgG2a Fc-tagged | +Inquiry |
IL10-217H | Recombinant Human Interleukin 10 | +Inquiry |
IL10-996P | Recombinant Pig IL10 Protein, His&GST-tagged | +Inquiry |
IL10-22R | Recombinant Rhesus macaque IL10 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *