Recombinant Rhesus macaque IL10 Protein, His/Myc-tagged

Cat.No. : IL10-23R
Product Overview : Recombinant Rhesus macaque IL10(19-178aa) fused with His tag at N-terminal and Myc tag at C-terminalwas expressed in Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : Insect Cells
Tag : His&Myc
Protein Length : 19-178aa
Form : Tris-based buffer, 50% glycerol
AA Sequence : SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name IL10 interleukin 10 [ Macaca mulatta ]
Official Symbol IL10
Synonyms CSIF; IL-10; cytokine synthesis inhibitory factor
Gene ID 694931
mRNA Refseq NM_001044727
Protein Refseq NP_001038192
UniProt ID P51496

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL10 Products

Required fields are marked with *

My Review for All IL10 Products

Required fields are marked with *

0
cart-icon