Recombinant Rhesus Macaque S100 Calcium Binding Protein B

Cat.No. : S100B-5482R
Product Overview : Recombinant Rhesusmacaque S100 calcium binding protein B is a single, non-glycosylatedpolypeptide chain containing 92 amino acids.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : Non
Description : S100B isglial-specific and is expressed primarily by astrocytes. Not all astrocytes expressS100B. It has been shown that S100B is only expressed by a subtype of mature astrocytesthat ensheath blood vessels and by NG2-expressing cells. This protein mayfunction in neurite extension,proliferation of melanoma cells, stimulation ofCa2+ fluxes,inhibition of PKC-mediatedphosphorylation,astrocytosis and axonal proliferation, and inhibition ofmicrotubule assembly. In the developing CNS, it acts as a neurotrophic factorand neuronal survival protein.
Form : Lyophilized from a0.2μm filtered concentrated solution in PBS, pH 7.4.
Purity : >97%by SDS-PAGEand HPLC analyses
Endotoxin Level : <0.1 ng/μg ofprotein.
Amino Acid Sequence : MSELEKAMVALIDVFHQYSG REGDKHKLKK SELKELINNE LSHFLEEIKEQEVVDKVMETLDSDGDGECD FQEFMAFVAM VTTACHEFFE HE
Molecular Weight : 10.7 kDa
Reconstitution : Centrifuge vialprior to opening.Reconstitute in sterile distilled water or aqueous buffercontaining 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutionsshould be divided into working aliquots and stored at -80°C. Furtherdilutions should be made in appropriate buffered solutions.
Storage : The lyophilizedprotein is stable at 2-4°C, but should be kept desiccated at -20°C for long termstorage. After reconstitution, the protein is stable for 1 week at 2-4°C. Forlong term storage, aliquot and freeze at -80°C. Avoid repeated freeze-thawcycles.
OfficialSymbol : S100B
Gene Name S100B S100 calcium bindingprotein B [ Macaca mulatta ]
Synonyms S100B;S100 calcium binding protein B
Gene ID 708117
mRNA Refseq XM_001098016
Protein Refseq XP_001098016
UniProt ID F7ANQ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100B Products

Required fields are marked with *

My Review for All S100B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon