Recombinant Rhesus macaque TFPI Protein
Cat.No. : | TFPI-753R |
Product Overview : | Recombinant Rhesus macaque TFPI protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | HEK293 |
Protein Length : | 304 |
Description : | This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. |
Form : | Lyophilized |
Molecular Mass : | 31.1 kDa |
AA Sequence : | MIYTMKKVHALWVSICLMLNLAPAPLNADSEEDEEYTIITDTELPPLKLMHSFCAFKPDDGPCKAIMKRFFFNIFTRQCEEFIYGGCGGNQNRFESMEECKKVCTRDNVHRIIQTALQQEKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNMNNFETLEECKNTCEDGLNGFQVDNYGTQLNAVNNSQTPQSTKVPSFFEFHGPSWCLAPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKRECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEVFVKNM |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | TFPI tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | TFPI |
Synonyms | TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); tissue factor pathway inhibitor; extrinsic pathway inhibitor; lipoprotein-associated coagulation inhibitor; EPI; LACI; |
Gene ID | 613026 |
mRNA Refseq | NM_001195022 |
Protein Refseq | NP_001181951 |
UniProt ID | Q28864 |
◆ Recombinant Proteins | ||
TFPI-752H | Recombinant Human TFPI Protein | +Inquiry |
TFPI-876H | Recombinant Human TFPI protein, His-tagged, Biotinylated | +Inquiry |
TFPI-6424H | Recombinant Human TFPI Protein (Asp29-Phe209), N-His tagged | +Inquiry |
TFPI-3565H | Recombinant Human TFPI protein, GST-tagged | +Inquiry |
TFPI-3566R | Recombinant Rabbit TFPI protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFPI-2746HCL | Recombinant Human TFPI cell lysate | +Inquiry |
TFPI-2843MCL | Recombinant Mouse TFPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFPI Products
Required fields are marked with *
My Review for All TFPI Products
Required fields are marked with *
0
Inquiry Basket