Recombinant Rhesus monkey CBLN1 Protein, His&Avi tagged, Biotinylated

• Cat.No.: CBLN1-641R
• Product Overview: Biotinylated recombinant Rhesus monkey CBLN1 Protein with His&Avi tag was expressed in HEK293.

Specification

• Species: Rhesus monkey
• Source: HEK293
• Tag: Avi&His
• Protein Length: 22-193 aa
• Conjugation/Label: Biotin
• Form: Sterile PBS, pH 7.4
• Molecular Mass: 22 kDa
• AASequence: HHHHHHHHGLNDIFEAQKIEWHEQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGSNFDSERSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL
• Endotoxin: < 1 EU/μg by LAL
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.54 mg/mL by BCA

Gene Information

• Gene Name: CBLN1 cerebellin 1 precursor [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: CBLN1
• Synonyms: CBLN1; cerebellin 1 precursor; cerebellin-1
• Gene ID: 102118708
• mRNA Refseq: XM_005591869
• Protein Refseq: XP_005591926
• UniProt ID: G7Q132