Recombinant Rhesus Monkey IL15 Protein, His-tagged
Cat.No. : | IL15-01R |
Product Overview : | Recombinant Rhesus Monkey IL15 (aa49-162) Protein with a 6×His tag N-terminus was expressed in yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | Yeast |
Tag : | His |
Protein Length : | 49-162 a.a. |
Description : | Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. |
Molecular Mass : | 14.9 kD |
AA Sequence : | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
Notes : | For research use only. |
Storage : | Short term: -20 centigrade; Long term: -80 centigrade; Avoid freeze-thaw cycles. |
Storage Buffer : | Tris, 50% Glycerol |
Gene Name | IL15 interleukin 15 [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | IL15 |
Synonyms | IL15; interleukin 15; IL-15; interleukin-15 |
Gene ID | 699616 |
mRNA Refseq | NM_001044731 |
Protein Refseq | NP_001038196 |
UniProt ID | P48092 |
◆ Recombinant Proteins | ||
IL15-80G | Recombinant Guinea Pig IL-15 | +Inquiry |
IL15-1006C | Recombinant Chicken IL15 Protein, His-tagged | +Inquiry |
IL15-100H | Active Recombinant Human IL15 Protein | +Inquiry |
IL15-382H | Recombinant Human IL15 protein | +Inquiry |
IL15-861S | Recombinant Sheep IL15 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL15 Products
Required fields are marked with *
My Review for All IL15 Products
Required fields are marked with *