Recombinant Rhesus Monkey IL15 Protein, His-tagged

• Cat.No.: IL15-01R
• Product Overview: Recombinant Rhesus Monkey IL15 (aa49-162) Protein with a 6×His tag N-terminus was expressed in yeast.

Specification

• Species: Rhesus macaque
• Source: Yeast
• Tag: His
• Protein Length: 49-162 a.a.
• Description: Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
• Molecular Mass: 14.9 kD
• AA Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Notes: For research use only.
• Storage: Short term: -20 centigrade;
  Long term: -80 centigrade;
  Avoid freeze-thaw cycles.
• Storage Buffer: Tris, 50% Glycerol

Gene Information

• Gene Name: IL15 interleukin 15 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: IL15
• Synonyms: IL15; interleukin 15; IL-15; interleukin-15
• Gene ID: 699616
• mRNA Refseq: NM_001044731
• Protein Refseq: NP_001038196
• UniProt ID: P48092