Recombinant Rhesus Monkey IL15 Protein, His-tagged

Cat.No. : IL15-01R
Product Overview : Recombinant Rhesus Monkey IL15 (aa49-162) Protein with a 6×His tag N-terminus was expressed in yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : Yeast
Tag : His
Protein Length : 49-162 a.a.
Description : Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Molecular Mass : 14.9 kD
AA Sequence : NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Notes : For research use only.
Storage : Short term: -20 centigrade;
Long term: -80 centigrade;
Avoid freeze-thaw cycles.
Storage Buffer : Tris, 50% Glycerol
Gene Name IL15 interleukin 15 [ Macaca mulatta (Rhesus monkey) ]
Official Symbol IL15
Synonyms IL15; interleukin 15; IL-15; interleukin-15
Gene ID 699616
mRNA Refseq NM_001044731
Protein Refseq NP_001038196
UniProt ID P48092

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL15 Products

Required fields are marked with *

My Review for All IL15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon