Recombinant Rhesus monkey IL2 Protein, His-SUMO/MYC-tagged
Cat.No. : | IL2-1256R |
Product Overview : | Recombinant Rhesus monkey IL2 Protein (21-154aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 21-154 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 35.5 kDa |
AA Sequence : | APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVL NLAQSKNFHLRDTKDLISNINVIVLELKGSETTLMCEYADETATIVEFLNRWITFCQSIISTLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | IL2 interleukin 2 [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | IL2 |
Synonyms | IL-2; interleukin 2; IL2 |
Gene ID | 708017 |
mRNA Refseq | NM_001047130.1 |
Protein Refseq | NP_001040595.1 |
UniProt ID | P68291 |
◆ Recombinant Proteins | ||
IL2-3100R | Recombinant Rabbit IL2 protein, His-tagged | +Inquiry |
IL2-167H | Active Recombinant Human IL2, MIgG2a Fc-tagged | +Inquiry |
IL2-3038R | Recombinant Rat IL2 Protein | +Inquiry |
Il2-104M | Active Recombinant Mouse Il2 Protein | +Inquiry |
IL2-168H | Active Recombinant Human il2, MIgG2a Fc-tagged, mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *