"IL2" Related Products

Recombinant Rhesus monkey IL2 Protein, His-SUMO/MYC-tagged

Cat.No.: IL2-1256R
Product Overview: Recombinant Rhesus monkey IL2 Protein (21-154aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC-tag.
Source: E. coli
Species: Rhesus monkey
Tag : His-SUMO/MYC
Form: Tris-based buffer, 50% glycerol.
Molecular Mass: 35.5 kDa
AA Sequence: APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVL
NLAQSKNFHLRDTKDLISNINVIVLELKGSETTLMCEYADETATIVEFLNRWITFCQSIISTLT
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name: IL2 interleukin 2 [ Macaca mulatta (Rhesus monkey) ]
Official Symbol: IL2
Synonyms: IL-2; interleukin 2; IL2
Gene ID: 708017
mRNA Refseq: NM_001047130.1
Protein Refseq: NP_001040595.1
UniProt ID: P68291

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.