Recombinant Rhesus monkey MCL1 Protein, His-tagged
Cat.No. : | MCL1-73R |
Product Overview : | Recombinant Rhesus monkey MCL1 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing. |
Form : | 50mM Tris, 300mM NaCl, pH 8.0. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.1 mg/ml |
Gene Name | MCL1 MCL1 apoptosis regulator, BCL2 family member [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | MCL1 |
Synonyms | TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT |
Gene ID | 707539 |
mRNA Refseq | NM_001266501 |
Protein Refseq | NP_001253430 |
UniProt ID | F7HUE9 |
◆ Cell & Tissue Lysates | ||
MCL1-4422HCL | Recombinant Human MCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MCL1 Products
Required fields are marked with *
My Review for All MCL1 Products
Required fields are marked with *
0
Inquiry Basket