| Species : |
Rhesus macaque |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing. |
| Form : |
50mM Tris, 300mM NaCl, pH 8.0. |
| Molecular Mass : |
39.3 kDa |
| AA Sequence : |
MGSSHHHHHHSSGLVPRGSHMFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR |
| Purity : |
>90% |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.1 mg/ml |
