Recombinant Rhesus monkey MCL1 Protein, His-tagged

Cat.No. : MCL1-73R
Product Overview : Recombinant Rhesus monkey MCL1 Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : E.coli
Tag : His
Description : This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing.
Form : 50mM Tris, 300mM NaCl, pH 8.0.
Molecular Mass : 39.3 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTASPARLLFFAPTRRASPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.1 mg/ml
Gene Name MCL1 MCL1 apoptosis regulator, BCL2 family member [ Macaca mulatta (Rhesus monkey) ]
Official Symbol MCL1
Synonyms TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT
Gene ID 707539
mRNA Refseq NM_001266501
Protein Refseq NP_001253430
UniProt ID F7HUE9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MCL1 Products

Required fields are marked with *

My Review for All MCL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon