Recombinant Rhesus monkey PTHLH Protein, His-tagged
| Cat.No. : | PTHLH-3695R |
| Product Overview : | Recombinant Rhesus monkey PTHLH Protein, His-tagged,expressed in HEK293. |
| Availability | January 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus macaque |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 25-177 aa |
| Tag : | His |
| Molecular Mass : | 19 kDa |
| AA Sequence : | RSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHSVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRHHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.12mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Gene Name | PTHLH parathyroid hormone like hormone [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | PTHLH |
| Synonyms | PTHLH; parathyroid hormone-related protein; parathyroid hormone-related protein isoform 1 preproprotein |
| Gene ID | 710295 |
| mRNA Refseq | NM_001261680 |
| Protein Refseq | NP_001248609 |
| UniProt ID | H9EU77 |
| ◆ Recombinant Proteins | ||
| PTHLH-6076H | Recombinant Human PTHLH Protein (Ala37-Arg175), C-His tagged | +Inquiry |
| PTHLH-4076C | Recombinant Chicken PTHLH | +Inquiry |
| PTHLH-5533H | Recombinant Human PTHLH protein, His-tagged | +Inquiry |
| PTHLH-4480R | Recombinant Rat PTHLH Protein, His (Fc)-Avi-tagged | +Inquiry |
| PTHLH-7764C | Recombinant Cattle PTHLH protein, His & S-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTHLH-2702HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
| PTHLH-2703HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
| PTHLH-2701HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTHLH Products
Required fields are marked with *
My Review for All PTHLH Products
Required fields are marked with *
