Recombinant Rhesus monkey PTHLH Protein, His-tagged
Cat.No. : | PTHLH-3695R |
Product Overview : | Recombinant Rhesus monkey PTHLH Protein, His-tagged,expressed in HEK293. |
Availability | August 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | HEK293 |
Tag : | His |
Protein Length : | 25-177 aa |
Tag : | His |
Molecular Mass : | 19 kDa |
AA Sequence : | RSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHSVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRHHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.12mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH7.4 |
Gene Name | PTHLH parathyroid hormone like hormone [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | PTHLH |
Synonyms | PTHLH; parathyroid hormone-related protein; parathyroid hormone-related protein isoform 1 preproprotein |
Gene ID | 710295 |
mRNA Refseq | NM_001261680 |
Protein Refseq | NP_001248609 |
UniProt ID | H9EU77 |
◆ Recombinant Proteins | ||
Pthlh-7767M | Recombinant Mouse Pthlh protein, His-tagged | +Inquiry |
PTHLH-664H | Recombinant Human PTHLH protein | +Inquiry |
PTHLH-7766C | Recombinant Chicken PTHLH protein, His & S-tagged | +Inquiry |
PTHLH-7764C | Recombinant Cattle PTHLH protein, His & S-tagged | +Inquiry |
PTHLH-4821R | Recombinant Rat PTHLH Protein | +Inquiry |
◆ Native Proteins | ||
PTHLH-322H | Recombinant Human PTHLH Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTHLH-2703HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2702HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
PTHLH-2701HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTHLH Products
Required fields are marked with *
My Review for All PTHLH Products
Required fields are marked with *