Recombinant Rhesus Monkey TNFRSF12A Protein, hIgG1 tagged

• Cat.No.: TNFRSF12A-1646R
• Product Overview: Recombinant Rhesus Monkey TNFRSF12A Protein with hIgG1 tag was expressed in HEK293.

Specification

• Species: Rhesus macaque
• Source: HEK293
• Tag: Fc
• Description: Involved in positive regulation of extrinsic apoptotic signaling pathway and regulation of wound healing. Predicted to be located in cell surface and ruffle. Predicted to be active in plasma membrane.
• Molecular Mass: The protein has a calculated MW of 35 kDa.
• AA Sequence: LRSVAGEQAPGTRDLGVGEPRSGAREPDWVPGEQRGTGGTGGCTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Purity: > 95% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 3.12 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH 7.4

Gene Information

• Gene Name: TNFRSF12A TNF receptor superfamily member 12A [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: TNFRSF12A
• Synonyms: TNFRSF12A; TNF receptor superfamily member 12A; tumor necrosis factor receptor superfamily member 12A
• Gene ID: 699970
• mRNA Refseq: XM_001089176
• Protein Refseq: XP_001089176
• UniProt ID: G7NP59