Recombinant Rhesus Monkey TNFRSF12A Protein, hIgG1 tagged
Cat.No. : | TNFRSF12A-1646R |
Product Overview : | Recombinant Rhesus Monkey TNFRSF12A Protein with hIgG1 tag was expressed in HEK293. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | HEK293 |
Tag : | Fc |
Description : | Involved in positive regulation of extrinsic apoptotic signaling pathway and regulation of wound healing. Predicted to be located in cell surface and ruffle. Predicted to be active in plasma membrane. |
Molecular Mass : | The protein has a calculated MW of 35 kDa. |
AA Sequence : | LRSVAGEQAPGTRDLGVGEPRSGAREPDWVPGEQRGTGGTGGCTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 3.12 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
Gene Name | TNFRSF12A TNF receptor superfamily member 12A [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | TNFRSF12A |
Synonyms | TNFRSF12A; TNF receptor superfamily member 12A; tumor necrosis factor receptor superfamily member 12A |
Gene ID | 699970 |
mRNA Refseq | XM_001089176 |
Protein Refseq | XP_001089176 |
UniProt ID | G7NP59 |
◆ Recombinant Proteins | ||
TNFRSF12A-441H | Recombinant Human TNFRSF12A Protein, His&GST-tagged | +Inquiry |
TNFRSF12A-7734H | Recombinant Human TNFRSF12A protein, His & GST-tagged | +Inquiry |
TNFRSF12A-471H | Recombinant Human TNFRSF12A Protein, Fc-tagged | +Inquiry |
Tnfrsf12a-42M | Active Recombinant Mouse Fn-14, Fc-tagged | +Inquiry |
TNFRSF12A-30125TH | Recombinant Human TNFRSF12A, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF12A-1560HCL | Recombinant Human TNFRSF12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF12A Products
Required fields are marked with *
My Review for All TNFRSF12A Products
Required fields are marked with *