Recombinant Rhesus Monkey TNFRSF12A Protein, hIgG1 tagged

Cat.No. : TNFRSF12A-1646R
Product Overview : Recombinant Rhesus Monkey TNFRSF12A Protein with hIgG1 tag was expressed in HEK293.
Availability November 05, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : HEK293
Tag : Fc
Description : Involved in positive regulation of extrinsic apoptotic signaling pathway and regulation of wound healing. Predicted to be located in cell surface and ruffle. Predicted to be active in plasma membrane.
Molecular Mass : The protein has a calculated MW of 35 kDa.
AA Sequence : LRSVAGEQAPGTRDLGVGEPRSGAREPDWVPGEQRGTGGTGGCTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 3.12 mg/mL by BCA
Storage Buffer : Sterile PBS, pH 7.4
Gene Name TNFRSF12A TNF receptor superfamily member 12A [ Macaca mulatta (Rhesus monkey) ]
Official Symbol TNFRSF12A
Synonyms TNFRSF12A; TNF receptor superfamily member 12A; tumor necrosis factor receptor superfamily member 12A
Gene ID 699970
mRNA Refseq XM_001089176
Protein Refseq XP_001089176
UniProt ID G7NP59

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF12A Products

Required fields are marked with *

My Review for All TNFRSF12A Products

Required fields are marked with *

0
cart-icon
0
compare icon