Recombinant Rhizobium Leguminosarum NIFH Protein (1-47 aa), His-GST-Myc-tagged
Cat.No. : | NIFH-2467R |
Product Overview : | Recombinant Rhizobium Leguminosarum NIFH Protein (1-47 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Leguminosarum |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 1-47 aa |
Description : | The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.0 kDa |
AA Sequence : | MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | nifH nitrogenase iron protein [ Rhizobium leguminosarum bv. trifolii WSM2304 ] |
Official Symbol | NIFH |
Synonyms | nifH; |
Gene ID | 34190633 |
UniProt ID | P20623 |
◆ Recombinant Proteins | ||
NIFH-2467R | Recombinant Rhizobium Leguminosarum NIFH Protein (1-47 aa), His-GST-Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIFH Products
Required fields are marked with *
My Review for All NIFH Products
Required fields are marked with *
0
Inquiry Basket