Recombinant Rhizobium Leguminosarum NIFH Protein (1-47 aa), His-GST-Myc-tagged

Cat.No. : NIFH-2467R
Product Overview : Recombinant Rhizobium Leguminosarum NIFH Protein (1-47 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhizobium Leguminosarum
Source : E.coli
Tag : GST&His&Myc
Protein Length : 1-47 aa
Description : The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 35.0 kDa
AA Sequence : MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name nifH nitrogenase iron protein [ Rhizobium leguminosarum bv. trifolii WSM2304 ]
Official Symbol NIFH
Synonyms nifH;
Gene ID 34190633
UniProt ID P20623

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NIFH Products

Required fields are marked with *

My Review for All NIFH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon