Recombinant Rhizobium Meliloti LSPL Protein (1-341 aa), His-SUMO-tagged
Cat.No. : | LSPL-1777R |
Product Overview : | Recombinant Rhizobium Meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) LSPL Protein (1-341 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium Meliloti |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-341 aa |
Description : | UDP-glucuronate = UDP-L-iduronate |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 54.1 kDa |
AA Sequence : | MRYLITGTAGFIGFHVAKRLIDEGHFVVGFDGMTPYYDVTLKERRHAILQRSNGFKAVTAMLEDRAALDRAAELAEPEVIIHLAAQAGVRYSLENPKAYVDANLVGSWNMLELAKAIAPKHLMLASTSSIYGANEKIPFAEADRADEPMTLYAATKKSMELMAHSYAHLYKVPTTSFRFFTVYGPWGRPDMALFKFVDAIHNGRPIDIYGEGRMSRDFTYIDDLVESIVRLSHVPPSEENRVAPEKATDTLSRHAPFRVVNTGGGQPVELMTFVETVEKAVGRPAIHNMLPMQQGDVPRTFASPDLLEALTGFKPSVSVEEGVARFVEWYDQNYRRAHTTV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | lspL; UDP-glucuronic acid epimerase; |
UniProt ID | O54067 |
◆ Recombinant Proteins | ||
LSPL-1777R | Recombinant Rhizobium Meliloti LSPL Protein (1-341 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSPL Products
Required fields are marked with *
My Review for All LSPL Products
Required fields are marked with *
0
Inquiry Basket