Recombinant Rubella virus Structural polyprotein, His-SUMO-tagged
Cat.No. : | poly-643R |
Product Overview : | Recombinant Rubella virus Structural polyprotein(Q8VA10)(301-534aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rubella virus (strain RN-UK86) |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 301-534a.a. |
Tag : | His&SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GLQPRADMAAPPAPPQPPCAHGQHYGHHHHQLPFLGHDGHHGGTLRVGQHHRNASDVLPGHCLQGGWGCYNLSDWHQGTHVCHTKHMDFWCVEHDRPPPATPTPLTTAANSTTAATPATAPAPCHAGLNDSCGGFLSGCGPMRLRHGADTRCGRLICGLSTTAQYPPTRFACAMRWGLPPWELVVLTARPEDGWTCRGVPAHPGTRCPELVSPMGRATCSPASALWLATANALS |
◆ Recombinant Proteins | ||
POLY-0003D | Recombinant Dengue fever 2 NS1 antigen | +Inquiry |
Poly-573S | Recombinant Semliki forest virus (SFV) Poly protein, His&Myc-tagged | +Inquiry |
D3-01D | Recombinant DENV3 DIII envelope protein, His-tagged | +Inquiry |
poly-5765S | Recombinant Sindbis virus Non-structural polyprotein, His-tagged | +Inquiry |
POLY-0038D | Recombinant Dengue fever 1 NS1 antigen | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All poly Products
Required fields are marked with *
My Review for All poly Products
Required fields are marked with *