Recombinant S. alboniger Puromycin N-acetyltransferase Protein, His-SUMO-tagged.
Cat.No. : | pac-1317S |
Product Overview : | Recombinant S. alboniger ECs3104 Protein (1-199aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.alboniger |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-199 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 37.5 kDa |
AA Sequence : | MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDG AAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLG SAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Puromycin N-acetyltransferase |
Official Symbol | Puromycin N-acetyltransferase |
Synonyms | Puromycin N-acetyltransferase; pac |
UniProt ID | P13249 |
◆ Recombinant Proteins | ||
pac-1317S | Recombinant S. alboniger Puromycin N-acetyltransferase Protein, His-SUMO-tagged. | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Puromycin N-acetyltransferase Products
Required fields are marked with *
My Review for All Puromycin N-acetyltransferase Products
Required fields are marked with *