Recombinant S. aureus 30 kDa neutral phosphatase Protein, His-SUMO-tagged
Cat.No. : | NPTase-1105S |
Product Overview : | Recombinant Staphylococcus aureus 30 kDa neutral phosphatase was expressed in E. coli with N-terminal 6xHis-SUMO-tag. This is a highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | S. aureus |
Tag : | His-SUMO |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 19.85 kDa |
AA Sequence : | KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name : | 30 kDa neutral phosphatase |
Official Symbol : | 30 kDa neutral phosphatase |
Synonyms : | 30 kDa neutral phosphatase; NPTase; EC= 3.1.-.- |
UniProt ID : | P21222 |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All 30 kDa neutral phosphatase Products
Required fields are marked with *
My Review for All 30 kDa neutral phosphatase Products
Required fields are marked with *
0
Inquiry Basket