Recombinant S. aureus 30 kDa neutral phosphatase Protein, His-SUMO-tagged
| Cat.No. : | NPTase-1105S |
| Product Overview : | Recombinant Staphylococcus aureus 30 kDa neutral phosphatase was expressed in E. coli with N-terminal 6xHis-SUMO-tag. This is a highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | S.aureus |
| Source : | E.coli |
| Tag : | His&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 19.85 kDa |
| AA Sequence : | KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | 30 kDa neutral phosphatase |
| Official Symbol | 30 kDa neutral phosphatase |
| Synonyms | 30 kDa neutral phosphatase; NPTase; EC= 3.1.-.- |
| UniProt ID | P21222 |
| ◆ Recombinant Proteins | ||
| NPTase-1105S | Recombinant S. aureus 30 kDa neutral phosphatase Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All 30 kDa neutral phosphatase Products
Required fields are marked with *
My Review for All 30 kDa neutral phosphatase Products
Required fields are marked with *
Recently Viewed
