Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant S. aureus 30 kDa neutral phosphatase Protein, His-SUMO-tagged

Cat.No. : NPTase-1105S
Product Overview : Recombinant Staphylococcus aureus 30 kDa neutral phosphatase was expressed in E. coli with N-terminal 6xHis-SUMO-tag. This is a highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae.
  • Specification
  • Gene Information
  • Related Products
Source : E. coli
Species : S. aureus
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 19.85 kDa
AA Sequence : KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : 30 kDa neutral phosphatase
Official Symbol : 30 kDa neutral phosphatase
Synonyms : 30 kDa neutral phosphatase; NPTase; EC= 3.1.-.-
UniProt ID : P21222

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All 30 kDa neutral phosphatase Products

Required fields are marked with *

My Review for All 30 kDa neutral phosphatase Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends