Recombinant S. aureus Enterotoxin type C-2 Protein, His-SUMO-tagged
Cat.No. : | entC2-1200S |
Product Overview : | Recombinant S. aureus Enterotoxin type C-2 Protein (28-266aa) was expressed in E. coli with His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.aureus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 28-266 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 43.6 kDa |
AA Sequence : | ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLN EDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKR NTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQ SKYLMMYNDNKTVDSKSVKIEVHLTTKNG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Enterotoxin type C-2 |
Official Symbol | Enterotoxin type C-2 |
Synonyms | Enterotoxin type C-2; entC2; SEC2 |
UniProt ID | P34071 |
◆ Recombinant Proteins | ||
entC2-1200S | Recombinant S. aureus Enterotoxin type C-2 Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Enterotoxin type C-2 Products
Required fields are marked with *
My Review for All Enterotoxin type C-2 Products
Required fields are marked with *