Recombinant S. aureus Enterotoxin type E Protein, His-tagged
Cat.No. : | entE-1201S |
Product Overview : | Recombinant Staphylococcus aureus Enterotoxin type E (28-257aa) protein was expressed in Baculovirus with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.aureus |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 28-257 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 28.4 kDa |
AA Sequence : | SEEINEKDLRKKSELQRNALSNLRQIYYYNEKAITENKESDDQFLENTLLFKGFFTGHPWYNDLLVDLGS KDATNKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWIDGKQTTVPIDKV KTSKKEVTVQELDLQARHYLHGKFGLYNSDSFGGKVQRGLIVFHSSEGSTVSYDLFDAQGQYPDTLLRIY RDNKTINSENLHIDLYLYTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Enterotoxin type E |
Official Symbol | Enterotoxin type E |
Synonyms | Enterotoxin type E; entE; SEE |
UniProt ID | P12993 |
◆ Recombinant Proteins | ||
entE-1201S | Recombinant S. aureus Enterotoxin type E Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Enterotoxin type E Products
Required fields are marked with *
My Review for All Enterotoxin type E Products
Required fields are marked with *