Recombinant S. aureus Enterotoxin type G Protein, His-SUMO-tagged
Cat.No. : | entG-1202S |
Product Overview : | Recombinant Staphylococcus aureus (strain N315) Enterotoxin type G Protein (26-258aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.aureus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-258 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 43.0 kDa |
AA Sequence : | QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTE LANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGF TITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFL NIYGDNKVVDSKSIKMEVFLNTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Enterotoxin type G |
Official Symbol | Enterotoxin type G |
Synonyms | Enterotoxin type G; entG; SEG |
UniProt ID | P0A0L7 |
◆ Recombinant Proteins | ||
entG-1202S | Recombinant S. aureus Enterotoxin type G Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Enterotoxin type G Products
Required fields are marked with *
My Review for All Enterotoxin type G Products
Required fields are marked with *